PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00025380-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 160aa MW: 17521.6 Da PI: 10.5173 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.7 | 1.4e-14 | 84 | 145 | 1 | 62 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ Le +vkeLe++N +L ++l++ ++e + l++ SMil_00025380-RA_Salv 84 DKENKRLKRLLRNRVSAQQARERKKAYLGDLEVRVKELESKNAELEERLSTFQNENQMLRKI 145 5899****************************************************998875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.0E-13 | 84 | 148 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.9E-13 | 85 | 146 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.082 | 86 | 149 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.5E-16 | 88 | 148 | No hit | No description |
SuperFamily | SSF57959 | 8.13E-13 | 88 | 146 | No hit | No description |
CDD | cd14704 | 1.21E-15 | 89 | 140 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 91 | 106 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
LIMLIGREEM QEPATTTSSI AASSLPSSSE RSSSSALNNE VKQGIESDDE IRRVPEMGGA 60 AAENAGAAQP SAAGSKRRGR SPADKENKRL KRLLRNRVSA QQARERKKAY LGDLEVRVKE 120 LESKNAELEE RLSTFQNENQ MLRKILKNTT AGPQEGRKGS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001234820.1 | 2e-66 | transcription factor HY5 | ||||
Swissprot | Q9SM50 | 2e-67 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A4D9AG54 | 1e-72 | A0A4D9AG54_SALSN; Transcription factor HY5 | ||||
STRING | Solyc08g061130.2.1 | 9e-66 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA8037 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 3e-34 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|