PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00024911-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

Dof

Protein Properties

Length: 90aa MW: 10590.1 Da PI: 10.4584

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00024911-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	127.7	3.5e-40	31	88	4	61
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 +kcprCds+ntkfCyynnyslsqPryfCkaCrryWt+GG+lrnvPvGgg+rk+k+ SMil_00024911-RA_Salv 31 PPQKCPRCDSANTKFCYYNNYSLSQPRYFCKACRRYWTHGGTLRNVPVGGGCRKSKRP 88 5689***************************************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	2.0E-34	33	87	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.208	33	87	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	2.0E-24	34	87	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	35	71	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MEPRRNDQDR LKHQQDHRVK PPETQQMAPP PPQKCPRCDS ANTKFCYYNN YSLSQPRYFC 60 KACRRYWTHG GTLRNVPVGG GCRKSKRPKP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:30626969}.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269\|PubMed:20220754, ECO:0000269\|PubMed:30626969}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011096324.2	3e-39	dof zinc finger protein DOF3.1
Swissprot	O24463	2e-32	PBF_MAIZE; Dof zinc finger protein PBF
Swissprot	Q84TE9	1e-32	DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBL	A0A4D8ZBK7	2e-38	A0A4D8ZBK7_SALSN; Uncharacterized protein
STRING	Gorai.009G168400.1	9e-36	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA88	24	419

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60200.1	7e-33	TARGET OF MONOPTEROS 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lang Z, et al. Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication. J. Hered., 2014 Jul-Aug. 105(4): p. 576-582 [PMID:24683184] Zhang Z,Zheng X,Yang J,Messing J,Wu Y Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7 [PMID:27621432] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]