![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00024159-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 182aa MW: 20832.4 Da PI: 5.0752 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 116.3 | 3.1e-36 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrF Ptdeel+v++L++k++ + + +vi+++++y ++PwdL+ k+ +e ++wyf+s+r +nr+t++gyW+ g SMil_00024159-RA_Salv 8 LPPGFRFYPTDEELLVHFLHRKAALLPYHP-DVIPDLHLYPYDPWDLDGKAMSEGRQWYFYSRR--------TPNRITETGYWQPIGV 86 79*************************998.99**************977778899******97........579************* PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++s+ g++vg+kk +fy g+ ++g+kt+W+mhey++ SMil_00024159-RA_Salv 87 EDPIFSSAGKKVGVKKYCAFYIGEPSQGVKTNWIMHEYKA 126 **************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-46 | 5 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.307 | 8 | 151 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-21 | 9 | 125 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MGDNKLNLPP GFRFYPTDEE LLVHFLHRKA ALLPYHPDVI PDLHLYPYDP WDLDGKAMSE 60 GRQWYFYSRR TPNRITETGY WQPIGVEDPI FSSAGKKVGV KKYCAFYIGE PSQGVKTNWI 120 MHEYKASNSS AKKTSSKIDR SKWVLCRVYE EDDDGGGGTE LSCLDEVFLS LDDLDEISLP 180 NS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-46 | 4 | 155 | 13 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-46 | 4 | 155 | 13 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-46 | 4 | 155 | 13 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-46 | 4 | 155 | 13 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swm_B | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swm_C | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swm_D | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swp_A | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swp_B | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swp_C | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
3swp_D | 6e-46 | 4 | 155 | 16 | 172 | NAC domain-containing protein 19 |
4dul_A | 6e-46 | 4 | 155 | 13 | 169 | NAC domain-containing protein 19 |
4dul_B | 6e-46 | 4 | 155 | 13 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011092697.1 | 2e-98 | NAC domain-containing protein 104 isoform X1 | ||||
Refseq | XP_020553092.1 | 2e-98 | NAC domain-containing protein 104 isoform X1 | ||||
Refseq | XP_020553093.1 | 2e-98 | NAC domain-containing protein 104 isoform X1 | ||||
Swissprot | Q8GWK6 | 4e-75 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A4D9BY50 | 1e-101 | A0A4D9BY50_SALSN; Uncharacterized protein | ||||
STRING | XP_009762857.1 | 3e-88 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 5e-73 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|