PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00020000-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 91aa MW: 10514.8 Da PI: 9.3344 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 26.3 | 1.3e-08 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+iN+ ++L++llP+ + +s K s +L+++++YI+sL SMil_00020000-RA_Salv 19 DQINELVSKLQQLLPEMHNRRSDKKSATKVLQETCNYIRSL 59 79**************558999999999***********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 1.0E-9 | 4 | 80 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 11.033 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 4.32E-10 | 19 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 6.9E-6 | 19 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MSSRRSRSRQ SGSSRITDDQ INELVSKLQQ LLPEMHNRRS DKKSATKVLQ ETCNYIRSLH 60 REVDDLSERL SELLENADTT QAALIRSLLM Q |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 37 | 43 | RRSDKKS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP257556 | 1e-153 | KP257556.1 Salvia miltiorrhiza clone 124 basic helix-loop-helix transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022736077.1 | 6e-48 | transcription factor PRE3-like | ||||
Swissprot | F4JCN9 | 4e-39 | PRE4_ARATH; Transcription factor PRE4 | ||||
TrEMBL | A0A0H3Y7P3 | 4e-57 | A0A0H3Y7P3_SALMI; Basic helix-loop-helix transcription factor | ||||
STRING | Migut.D01842.1.p | 1e-43 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA353 | 24 | 161 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74500.1 | 1e-25 | activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|