PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00010496-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 133aa MW: 14908.9 Da PI: 8.7676 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.9 | 1.6e-16 | 84 | 126 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lk SMil_00010496-RA_Salv 84 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENEMLKR 126 79**************************************995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.5E-15 | 74 | 127 | No hit | No description |
SMART | SM00338 | 3.6E-9 | 80 | 131 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.45 | 82 | 127 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.06E-11 | 84 | 128 | No hit | No description |
CDD | cd14707 | 4.12E-24 | 84 | 128 | No hit | No description |
Pfam | PF00170 | 1.8E-14 | 84 | 126 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 87 | 102 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MDELPDLCSC SSAAAATTKY DACLHAGPCN PATDSSRGKL CFGHWLPGSP DSVVFPTDGT 60 LSDTQTTRRK RVPPDNIAEK GVERRQKRMI KNRESAARSR ARKQAYTHEL ENKVSRLEEE 120 NEMLKRQQMT MVI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011069985.1 | 8e-34 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 2e-27 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A4D9A4U9 | 6e-33 | A0A4D9A4U9_SALSN; ABA responsive element binding factor | ||||
STRING | Migut.J01594.1.p | 6e-33 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3572 | 22 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 1e-29 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|