![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00008443-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 143aa MW: 15060.2 Da PI: 9.1456 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.7 | 7.7e-24 | 69 | 122 | 1 | 54 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelse 54 +CqvegC++dls++k y++rhkvC +hsk+p+v+v+gleqrfCqqCsr + + SMil_00008443-RA_Salv 69 RCQVEGCRVDLSDVKAYYSRHKVCGMHSKSPNVIVAGLEQRFCQQCSRCCVFLD 122 6***********************************************766555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.5E-24 | 63 | 116 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 17.717 | 67 | 143 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.01E-23 | 68 | 124 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.0E-17 | 70 | 116 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MDKGSSSSSS SSSSAGPDSL NGLKFGKKIY FEGVGSGLQQ PKTGAAPPLP PSPAKKGRTA 60 AVQGAQPPRC QVEGCRVDLS DVKAYYSRHK VCGMHSKSPN VIVAGLEQRF CQQCSRCCVF 120 LDVDWALPLN GAFLFISLSG HVV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 1e-14 | 70 | 124 | 6 | 60 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF437882 | 0.0 | KF437882.1 Salvia miltiorrhiza SQUAMOSA promoter binding protein-like 6 (SPL6) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011078846.1 | 5e-45 | squamosa promoter-binding-like protein 17 isoform X1 | ||||
Refseq | XP_022865346.1 | 2e-46 | squamosa promoter-binding-like protein 14 | ||||
Swissprot | A2X0Q6 | 8e-26 | SPL3_ORYSI; Squamosa promoter-binding-like protein 3 | ||||
Swissprot | A3A2Z8 | 8e-26 | SPL3_ORYSJ; Squamosa promoter-binding-like protein 3 | ||||
TrEMBL | A0A075FFM3 | 3e-75 | A0A075FFM3_SALMI; SQUAMOSA promoter binding protein-like 6 (Fragment) | ||||
STRING | XP_009776998.1 | 3e-42 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4571 | 22 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57920.1 | 9e-26 | squamosa promoter binding protein-like 15 |