PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00007265-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 139aa MW: 15904 Da PI: 7.5193 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 36.8 | 8.7e-12 | 18 | 76 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +rk +NRe+ArrsR RK++ ++eL +++ eNk+L++ ++ ++++ + se+ SMil_00007265-RA_Salv 18 RKRKRKLSNRESARRSRIRKQQHLDELIAQEQKMLDENKKLREMIDGASQLYLNFASEN 76 6789******************************************9999998887776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 3.1E-11 | 6 | 50 | No hit | No description |
SMART | SM00338 | 9.4E-16 | 14 | 78 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.461 | 16 | 63 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.5E-10 | 18 | 69 | No hit | No description |
Pfam | PF00170 | 5.5E-8 | 18 | 68 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 2.68E-17 | 19 | 69 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 21 | 36 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:3.40.50.300 | 8.4E-4 | 51 | 105 | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006971 | Biological Process | hypotonic response | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000693 | Biological Process | positive regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MASKQQQPAS PGSDGDERKR KRKLSNRESA RRSRIRKQQH LDELIAQEQK MLDENKKLRE 60 MIDGASQLYL NFASENNVLR AQVSELTDRL RSLNSVLQIA SEVSGFAFDI PDIPDTLLEP 120 WQLPCPVHPI PASVDMFQY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 16 | 23 | ERKRKRKL |
2 | 17 | 22 | RKRKRK |
3 | 30 | 37 | RRSRIRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00419 | DAP | Transfer from AT3G62420 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011079554.1 | 2e-84 | bZIP transcription factor 53 | ||||
Swissprot | Q9LZP8 | 8e-50 | BZP53_ARATH; bZIP transcription factor 53 | ||||
TrEMBL | A0A4D8ZXD0 | 6e-85 | A0A4D8ZXD0_SALSN; Uncharacterized protein | ||||
STRING | Migut.D00084.1.p | 5e-82 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2810 | 23 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 3e-52 | basic region/leucine zipper motif 53 |
Publications ? help Back to Top | |||
---|---|---|---|
|