![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00006239-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 178aa MW: 20883.1 Da PI: 5.288 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.9 | 1.5e-15 | 82 | 138 | 5 | 61 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +++rr+++NRe+ArrsR RK++ ++eL v L +eN++L ++l++ ++ +++ + SMil_00006239-RA_Salv 82 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSERHDQVLQ 138 689********************************************9998877665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-14 | 78 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.795 | 80 | 143 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.6E-14 | 82 | 140 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 8.9E-13 | 82 | 155 | No hit | No description |
SuperFamily | SSF57959 | 1.06E-13 | 82 | 132 | No hit | No description |
CDD | cd14702 | 1.14E-19 | 83 | 134 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MQPNEIAELH LLFPSNSAQY PPNFGSTSNY PPAYQFSRFP NPLYNLHATP QLQEFNPQTT 60 CFSSNSTSDE ADEQQLSIIN ERKQRRMISN RESARRSRMR KQKHLDELWS QVVWLRNENH 120 QLVDKLNHVS ERHDQVLQEN TQLKEEASEL RQMLTDMQLN SPYPSLRELD DDPSSELA |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 94 | 101 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011099071.1 | 1e-108 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-46 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A4D9B9G0 | 1e-116 | A0A4D9B9G0_SALSN; Uncharacterized protein | ||||
STRING | Migut.H00570.1.p | 2e-95 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 3e-55 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|