PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_54350.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 54aa MW: 6092.76 Da PI: 3.5921

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_54350.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	36.5	1.1e-11	11	52	3	45
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W ++E+ ll++a+ +G g+Wk + +++g +t +c+++++ Rsa1.0_54350.1_g00001.1 11 DWNADEEILLLEAIVTYGFGNWKEVVNYVG-SKTQAECIDYFN 52 5***************************.********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	8.22E-12	4	53	IPR009057	Homeodomain-like
PROSITE profile	PS51293	17.839	7	54	IPR017884	SANT domain
SMART	SM00717	0.0015	8	54	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-9	10	53	IPR009057	Homeodomain-like
Pfam	PF00249	5.0E-11	11	53	IPR001005	SANT/Myb domain
CDD	cd00167	1.04E-10	12	52	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
DNLSFPLVSC DWNADEEILL LEAIVTYGFG NWKEVVNYVG SKTQAECIDY FNSA

Functional Description ? help Back to Top
Source	Description
UniProt	Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_54350.1_g00001.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018492581.1	6e-29	PREDICTED: transcriptional adapter ADA2a-like
Swissprot	Q9SFD5	6e-25	TAD2A_ARATH; Transcriptional adapter ADA2a
TrEMBL	A0A078HEX0	4e-27	A0A078HEX0_BRANA; Transcriptional adapter
TrEMBL	A0A397ZF29	4e-27	A0A397ZF29_BRACM; Transcriptional adapter
TrEMBL	A0A3N6TEK1	4e-27	A0A3N6TEK1_BRACR; Uncharacterized protein
TrEMBL	A0A3P5YZ13	4e-27	A0A3P5YZ13_BRACM; Uncharacterized protein
TrEMBL	A0A3P6FCJ3	4e-27	A0A3P6FCJ3_BRAOL; Uncharacterized protein
TrEMBL	M4ELK5	4e-27	M4ELK5_BRARP; Transcriptional adapter
STRING	Bra029673.1-P	6e-28	(Brassica rapa)

Publications ? help Back to Top
Hark AT, et al. Two Arabidopsis orthologs of the transcriptional coactivator ADA2 have distinct biological functions. Biochim. Biophys. Acta, 2009. 1789(2): p. 117-24 [PMID:18929690]