![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_45408.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 110aa MW: 12305.9 Da PI: 9.6841 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 49.1 | 1e-15 | 5 | 61 | 34 | 91 |
SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 +++ l ++gr+W k++ + k+gr+ l++GW++F++an+Lk+gD+++ +l++++e++ Rsa1.0_45408.1_g00001.1 5 RMIYLLGRDGRKWLSKVQ-QDKKGRVSLGNGWRDFAEANNLKSGDSFTMELIWEEETR 61 5799*************6.5555789***************************85543 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01019 | 4.6E-5 | 1 | 69 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 13.479 | 1 | 69 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 2.4E-14 | 2 | 72 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 6.45E-13 | 2 | 65 | No hit | No description |
SuperFamily | SSF101936 | 7.65E-14 | 3 | 64 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.0E-13 | 5 | 61 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MNKLRMIYLL GRDGRKWLSK VQQDKKGRVS LGNGWRDFAE ANNLKSGDSF TMELIWEEET 60 RMLRLSGAES SSSKAYVSTE PGSSSDSSSA IQNRSVTLTL TPEEVRACKL |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_45408.1_g00001.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018433753.1 | 1e-62 | PREDICTED: B3 domain-containing protein REM13-like | ||||
Swissprot | P0CAP5 | 4e-31 | REM13_ARATH; B3 domain-containing protein REM13 | ||||
TrEMBL | A0A397Y2Q8 | 3e-53 | A0A397Y2Q8_BRACM; Uncharacterized protein | ||||
STRING | Bo8g099680.1 | 3e-53 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7828 | 16 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24650.1 | 3e-28 | DNA binding;DNA binding;sequence-specific DNA binding transcription factors |
Publications ? help Back to Top | |||
---|---|---|---|
|