PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

HB-other

Protein Properties

Length: 68aa MW: 8188.13 Da PI: 4.3441

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_41930.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	24.1	6.3e-08	33	67	6	40
S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS- CS Homeobox 6 tftkeqleeLeelFeknrypsaeereeLAkklgLt 40 ++t+eq+ Le+ Fe ++++ e++++LAk lgL Rsa1.0_41930.1_g00001.1 33 NLTHEQVPLLEKSFETENKLEPERKTQLAKMLGLR 67 789******************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.89E-6	31	67	IPR009057	Homeodomain-like
CDD	cd00086	4.26E-4	33	66	No hit	No description
Pfam	PF00046	4.4E-5	33	67	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	5.4E-7	34	67	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MNMEESSKRR PFYCSPDDLL YDYDYYDEQT PDNLTHEQVP LLEKSFETEN KLEPERKTQL 60 AKMLGLRP

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269\|PubMed:8535134}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_41930.1_g00001.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018453925.1	8e-43	PREDICTED: homeobox-leucine zipper protein HAT5-like
Swissprot	Q02283	1e-18	HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBL	A0A087H661	2e-24	A0A087H661_ARAAL; Uncharacterized protein
TrEMBL	A0A087H662	2e-24	A0A087H662_ARAAL; Uncharacterized protein
STRING	A0A087H661	3e-25	(Arabis alpina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM545	28	143

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G01470.1	3e-20	homeobox 1

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ribone PA,Capella M,Arce AL,Chan RL A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype. Plant Physiol., 2017. 175(3): p. 1238-1253 [PMID:28956754]