PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_32232.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 75aa MW: 8956.37 Da PI: 11.2001 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.3 | 2.2e-15 | 31 | 73 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r+rr++kNRe+A rsR+R++a++ eLe + +L++eN++Lkk Rsa1.0_32232.1_g00001.1 31 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENMKLKK 73 79***************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.0E-5 | 24 | 74 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.829 | 29 | 75 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.3E-15 | 30 | 73 | No hit | No description |
Pfam | PF00170 | 2.6E-13 | 31 | 74 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.81E-11 | 31 | 73 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 34 | 49 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
NGRSEQYLTG LNAFRIQKRI IDGPPEILME RRQRRMIKNR ESAARSRARR QAYTVELELE 60 LNQLTEENMK LKKIV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Could participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_32232.1_g00001.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018437699.1 | 2e-44 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
Refseq | XP_018437731.1 | 2e-44 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
Swissprot | Q8RYD6 | 2e-32 | AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1 | ||||
TrEMBL | A0A078F7P7 | 5e-42 | A0A078F7P7_BRANA; BnaCnng04010D protein | ||||
STRING | XP_010535682.1 | 1e-35 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11652 | 22 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44460.1 | 2e-23 | bZIP family protein |