PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_23774.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 61aa MW: 6807.87 Da PI: 10.8148 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien rqvtfskRrng++KKA+ELS+LCdaevavi+fsstgk y++ss Rsa1.0_23774.1_g00001.1 9 KKIENVNSRQVTFSKRRNGLMKKANELSILCDAEVAVIVFSSTGKAYDFSS 59 78***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.623 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.1E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.88E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.66E-36 | 2 | 59 | No hit | No description |
PRINTS | PR00404 | 1.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
MGRGRIEIKK IENVNSRQVT FSKRRNGLMK KANELSILCD AEVAVIVFSS TGKAYDFSSG 60 R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-19 | 1 | 59 | 1 | 59 | MEF2C |
5f28_B | 9e-19 | 1 | 59 | 1 | 59 | MEF2C |
5f28_C | 9e-19 | 1 | 59 | 1 | 59 | MEF2C |
5f28_D | 9e-19 | 1 | 59 | 1 | 59 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_23774.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189231 | 4e-57 | AC189231.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB013M01, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018513743.1 | 1e-35 | PREDICTED: agamous-like MADS-box protein AGL18 isoform X1 | ||||
Refseq | XP_018513744.1 | 1e-35 | PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 | ||||
Swissprot | Q9M2K8 | 8e-32 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
TrEMBL | M4DDR0 | 5e-35 | M4DDR0_BRARP; Uncharacterized protein | ||||
STRING | Bra014628.1-P | 8e-36 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57390.1 | 3e-34 | AGAMOUS-like 18 |