|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Rsa1.0_07505.1_g00001.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
M-type_MADS |
Protein Properties |
Length: 83aa MW: 9339.63 Da PI: 9.8437 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Rsa1.0_07505.1_g00001.1 | genome | RGD | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 97.8 | 4.6e-31 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey++
Rsa1.0_07505.1_g00001.1 24 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN 74
79***********************************************85 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-19 | 18 | 74 | 3 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC189647 | 1e-131 | AC189647.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G24, complete sequence. |