![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_04673.1_g00004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 86aa MW: 8909.89 Da PI: 4.3022 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 35.3 | 3e-11 | 52 | 86 | 1 | 35 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevs 35 rW++qe+laL+++r++m+ ++r+++ k+plWeevs Rsa1.0_04673.1_g00004.1 52 RWPRQETLALLKIRSDMGIAFRDASVKGPLWEEVS 86 8*********************************8 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MQLGGSTTTA ATASAPPPSN DSATIEAAAA AAAVGAFEVS EEMNDRGFGG NRWPRQETLA 60 LLKIRSDMGI AFRDASVKGP LWEEVS |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_04673.1_g00004.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189203 | 9e-96 | AC189203.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006H21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018446335.1 | 5e-52 | PREDICTED: trihelix transcription factor GT-2 | ||||
TrEMBL | A0A397YNA2 | 3e-34 | A0A397YNA2_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6BBB9 | 3e-34 | A0A3P6BBB9_BRACM; Uncharacterized protein | ||||
STRING | Bra003703.1-P | 8e-35 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM32324 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76880.1 | 5e-30 | Trihelix family protein |