![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_04403.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 180aa MW: 20569.1 Da PI: 10.2415 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.9 | 1.2e-42 | 61 | 136 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv++C++dl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++ Rsa1.0_04403.1_g00002.1 61 CQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSS 136 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 3.1E-58 | 1 | 148 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 9.1E-33 | 56 | 122 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.231 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 8.37E-39 | 60 | 139 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.8E-32 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MEGKKAQGRG YLKKKASVST YLVDEELEND TDGEEEVGRE EEKRKGAIKG SSSDRVSSRL 60 CQVDRCTTDL KEAKQYHRRH KVCEVHAKAS SVYLAGVKQR FCQQCSRFHE LPEFDEAKRS 120 CRRRLAGHNE RRRKSSGESF GEGSGGRRGL TGQVMQNQER SRVEMTLPKS NTSFKRPQIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-44 | 59 | 134 | 9 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_04403.1_g00002.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ011632 | 1e-99 | AJ011632.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 4, partial. | |||
GenBank | AY084902 | 1e-99 | AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013746617.2 | 1e-108 | squamosa promoter-binding-like protein 5 | ||||
Refseq | XP_018514341.1 | 1e-108 | PREDICTED: squamosa promoter-binding-like protein 5 isoform X2 | ||||
Swissprot | Q9S758 | 5e-84 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A078GKE9 | 1e-109 | A0A078GKE9_BRANA; Squamosa promoter-binding-like protein | ||||
STRING | Bra038101.1-P | 1e-105 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 4e-65 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|