PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_02804.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 106aa MW: 12168.2 Da PI: 10.0109 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.1 | 7.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l++ ++++G +W++ ++ g+ R++k+c++rw +yl Rsa1.0_02804.1_g00002.1 14 RGPWTPAEDQILINHIHLYGHSNWRALPKLAGLLRCGKSCRLRWINYL 61 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.2E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.13 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 3.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.21E-23 | 15 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.56E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.252 | 62 | 106 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-9 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MGRAPCCEKM GMKRGPWTPA EDQILINHIH LYGHSNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPGIKRGNF TPKEEQTIIN LHEVLGNRCI FLLSRENYSS ICSTTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-15 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_02804.1_g00002.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519575 | 2e-82 | AY519575.1 Arabidopsis thaliana MYB transcription factor (At2g31180) mRNA, complete cds. | |||
GenBank | BT024853 | 2e-82 | BT024853.1 Arabidopsis thaliana At2g31180 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018440797.1 | 8e-62 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9SJX8 | 1e-57 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A1J3D047 | 5e-57 | A0A1J3D047_NOCCA; Myb-related protein Myb4 | ||||
TrEMBL | A0A1J3HQA0 | 4e-57 | A0A1J3HQA0_NOCCA; Myb-related protein Myb4 | ||||
STRING | Bra018267.1-P | 2e-57 | (Brassica rapa) | ||||
STRING | XP_006410249.1 | 2e-57 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 6e-60 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|