![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01459.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 19788 Da PI: 7.6257 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.2 | 3.2e-12 | 86 | 134 | 5 | 53 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 +++rr+ +NRe+ArrsR RK+ ++eL v L +eN L+++l++ Rsa1.0_01459.1_g00003.1 86 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNSVL 134 79****************************************9999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.2E-13 | 82 | 146 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.53 | 84 | 147 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.36E-12 | 86 | 135 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.7E-10 | 86 | 158 | No hit | No description |
Pfam | PF00170 | 2.2E-10 | 86 | 143 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 2.04E-17 | 87 | 135 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 89 | 104 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MIPAEISGYF QYLSPENLTT IPAEFNIIDM PSSPTSSSSL NYLNELINNN YSSSSNGQYV 60 MTSNNSTSDE DHHHNHRQSI IILDERKQRR MLSNRESARR SRMRKQRHLD ELWSQVIRLR 120 NENNCLIDKL NSVLETQDNV LKENSKLKEE ASDLRRLVCD LKSNKNNNSF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 98 | 105 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00262 | DAP | Transfer from AT2G04038 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01459.1_g00003.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018481694.1 | 1e-120 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 2e-32 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0D3AVT9 | 1e-94 | A0A0D3AVT9_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g138370.1 | 2e-95 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 4e-66 | basic leucine-zipper 48 |
Publications ? help Back to Top | |||
---|---|---|---|
|