![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01359.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 61aa MW: 6924.14 Da PI: 10.8154 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.6 | 3.9e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+n + rq++fskRr+g+lKKA+ELSvLCda+va i+fs++gklye++s Rsa1.0_01359.1_g00005.1 9 KRIDNLTSRQISFSKRRKGLLKKAHELSVLCDAQVAAIVFSQKGKLYEFAS 59 79***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.515 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.18E-33 | 3 | 60 | No hit | No description |
SuperFamily | SSF55455 | 9.03E-28 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
MVRGKIEIKR IDNLTSRQIS FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ KGKLYEFASS 60 E |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 3e-17 | 1 | 61 | 1 | 61 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01359.1_g00005.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232542 | 6e-59 | AC232542.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH005L20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018485063.1 | 9e-35 | PREDICTED: MADS-box protein AGL72-like | ||||
Swissprot | Q9FLH5 | 4e-31 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A0D3DDL6 | 1e-33 | A0A0D3DDL6_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3N6RXN1 | 1e-33 | A0A3N6RXN1_BRACR; Uncharacterized protein | ||||
STRING | Bo7g098670.1 | 2e-34 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 1e-33 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|