PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01245.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 168aa MW: 17811.6 Da PI: 6.3545 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 187.4 | 1.1e-58 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 reqdrflPianvsrimkk+lP+nakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfedyveplkvyl Rsa1.0_01245.1_g00005.1 20 REQDRFLPIANVSRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYL 105 89************************************************************************************ PP NF-YB 88 kkyrelegek 97 +kyrelege+ Rsa1.0_01245.1_g00005.1 106 QKYRELEGER 115 *******997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.0E-55 | 16 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.32E-40 | 22 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.9E-28 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-22 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-22 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 4.7E-22 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MADSDNDSGG HKDGGSASSR EQDRFLPIAN VSRIMKKALP GNAKISKDAK ETVQECVSEF 60 ISFVTGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKVYLQKYRE LEGERMTTGR 120 QGDKESGGGG GNGSSGGGGY NGGGGMYGGV VTMGHHHQGH VYGGSGIN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-49 | 14 | 110 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01245.1_g00005.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787662 | 0.0 | KC787662.1 Brassica napus transcription factor subunit NF-YB3A (NF-YB3A) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018486647.1 | 1e-120 | PREDICTED: nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 2e-86 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0D3CJR4 | 8e-97 | A0A0D3CJR4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A1J3G450 | 6e-96 | A0A1J3G450_NOCCA; Nuclear transcription factor Y subunit B-3 (Fragment) | ||||
TrEMBL | A0A3P6F1N5 | 8e-97 | A0A3P6F1N5_BRAOL; Uncharacterized protein | ||||
TrEMBL | W6D8P3 | 9e-97 | W6D8P3_BRANA; BnaC05g37390D protein | ||||
STRING | Bo5g126550.1 | 1e-97 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 8e-86 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|