 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Rsa1.0_01048.1_g00010.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
NAC |
Protein Properties |
Length: 94aa MW: 11265.3 Da PI: 4.3635 |
Description |
NAC family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Rsa1.0_01048.1_g00010.1 | genome | RGD | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 51.8 | 2.7e-16 | 49 | 94 | 2 | 48 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
+pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp
Rsa1.0_01048.1_g00010.1 49 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELP 94
79***************************.89**************8 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC189452 | 1e-112 | AC189452.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB072E02, complete sequence. |