![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00582.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 23968.1 Da PI: 9.8591 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.9 | 3.2e-15 | 26 | 73 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +l +++ +G g W+++a+ g++Rt+k+c++rw++yl Rsa1.0_00582.1_g00002.1 26 KGPWTMEEDWILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 73 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.2 | 1.6e-17 | 79 | 122 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++ Rsa1.0_00582.1_g00002.1 79 RGNITEEEQLLIIRLHAKLGNR-WSKIAKYLP-GRTDNEIKNFWRT 122 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.9 | 21 | 73 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.74E-29 | 24 | 120 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-10 | 25 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-13 | 26 | 73 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-21 | 27 | 80 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.57E-7 | 28 | 73 | No hit | No description |
PROSITE profile | PS51294 | 24.849 | 74 | 128 | IPR017930 | Myb domain |
SMART | SM00717 | 3.8E-16 | 78 | 126 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-16 | 79 | 122 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 81 | 127 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.88E-12 | 83 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MDTKKTEIRK ERIPSQKEEE EGTVRKGPWT MEEDWILFNY ILNHGEGLWN SVAKASGLKR 60 TGKSCRLRWL NYLRPDVRRG NITEEEQLLI IRLHAKLGNR WSKIAKYLPG RTDNEIKNFW 120 RTKIQRHVKL SSSVNTTNIR HCSGNSQSSV ITATDQGSSG KGFDMAESLI SPAKTTTSFH 180 VMEQSNDSYW NVEDQWPLQL LNGDHPVI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-27 | 26 | 128 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00324 | DAP | Transfer from AT3G01530 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00582.1_g00002.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK118091 | 1e-163 | AK118091.1 Arabidopsis thaliana At3g01530 mRNA for putative transcription factor, complete cds, clone: RAFL19-34-G03. | |||
GenBank | BT005574 | 1e-163 | BT005574.1 Arabidopsis thaliana clone U50886 putative myb family transcription factor (At3g01530) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018490235.1 | 1e-147 | PREDICTED: transcription factor MYB57-like | ||||
Swissprot | Q9SSA1 | 1e-109 | MYB57_ARATH; Transcription factor MYB57 | ||||
TrEMBL | A0A078IJ11 | 1e-139 | A0A078IJ11_BRANA; BnaC05g48910D protein | ||||
STRING | Bo5g155050.1 | 1e-136 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01530.1 | 1e-111 | myb domain protein 57 |