![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00517.1_g00011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 117aa MW: 13789.3 Da PI: 10.464 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 95.5 | 5.6e-30 | 6 | 96 | 8 | 98 |
DUF260 8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 r kC ++Cvl py+pa++p+k+a++ k+FG ++++++l+++++++r++ ++sl++eAear+rdPvyG vg+i++lq++l++l+ l+ Rsa1.0_00517.1_g00011.1 6 TRAKCRQECVLTPYLPANKPEKYACLMKVFGKKKLVRYLNEIDPSQRQACVDSLIFEAEARIRDPVYGTVGIIHRLQRRLQHLQLSLK 93 5789*******************************************************************************99888 PP DUF260 96 llk 98 ++ Rsa1.0_00517.1_g00011.1 94 IAR 96 766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.409 | 1 | 99 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.6E-29 | 6 | 95 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MELCATRAKC RQECVLTPYL PANKPEKYAC LMKVFGKKKL VRYLNEIDPS QRQACVDSLI 60 FEAEARIRDP VYGTVGIIHR LQRRLQHLQL SLKIARWELA KLKHEQNHRH LVIRSRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-26 | 7 | 99 | 19 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-26 | 7 | 99 | 19 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00517.1_g00011.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006468642.1 | 7e-30 | protein ASYMMETRIC LEAVES 2 | ||||
Refseq | XP_006468643.1 | 7e-30 | protein ASYMMETRIC LEAVES 2 | ||||
Swissprot | Q9FKZ3 | 2e-27 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A397YVE5 | 2e-51 | A0A397YVE5_BRACM; Uncharacterized protein | ||||
STRING | Bostr.6864s0195.1.p | 2e-31 | (Boechera stricta) | ||||
STRING | XP_010507369.1 | 9e-31 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 5e-27 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|