![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00250.1_g00017.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 196aa MW: 22222.3 Da PI: 9.8753 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.5 | 1.1e-18 | 62 | 116 | 2 | 56 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++t+eq + Le+ F++n++++ +++e LAk+l L rq+ vWFqNrRa+ k Rsa1.0_00250.1_g00017.1 62 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALAKHLMLRPRQIEVWFQNRRARSK 116 78889************************************************98 PP | |||||||
2 | HD-ZIP_I/II | 118.8 | 3e-38 | 62 | 150 | 1 | 89 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 +kk+rl++eq++lLE+sF+++++L+p++K++la++L l+prq++vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++evee Rsa1.0_00250.1_g00017.1 62 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNHRLHREVEE 147 69************************************************************************************ PP HD-ZIP_I/II 87 Lre 89 Lr+ Rsa1.0_00250.1_g00017.1 148 LRA 150 *94 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-18 | 45 | 119 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.45E-18 | 46 | 119 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.135 | 58 | 118 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.4E-17 | 60 | 122 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.66E-15 | 61 | 119 | No hit | No description |
Pfam | PF00046 | 6.3E-16 | 62 | 116 | IPR001356 | Homeobox domain |
PROSITE pattern | PS00027 | 0 | 93 | 116 | IPR017970 | Homeobox, conserved site |
SMART | SM00340 | 4.1E-21 | 118 | 161 | IPR003106 | Leucine zipper, homeobox-associated |
Pfam | PF02183 | 1.3E-9 | 118 | 152 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MAILPENYSN LDLTISVPGF SSSPPSDEGS GGGREQLKLD MNRLPSSEDD EELSLGGSAP 60 PRKKLRLTRE QSRLLEDSFR QNHTLNPKQK EALAKHLMLR PRQIEVWFQN RRARSKLKQT 120 EMECEYLKRW FGSLTEQNHR LHREVEELRA MKVGPSTAAT ASSLTMCPRC ERVTTAASPS 180 MAAPAKKTLP LKEREH |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 110 | 118 | RRARSKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00250.1_g00017.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353448 | 0.0 | AK353448.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-26-G16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018437350.1 | 1e-143 | PREDICTED: homeobox-leucine zipper protein ATHB-17-like isoform X2 | ||||
Swissprot | Q8S9N6 | 1e-120 | ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17 | ||||
TrEMBL | A0A1J3EZD3 | 1e-129 | A0A1J3EZD3_NOCCA; Homeobox-leucine zipper protein ATHB-17 | ||||
STRING | A0A087GU16 | 1e-128 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4890 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01430.1 | 7e-99 | homeobox-leucine zipper protein 17 |
Publications ? help Back to Top | |||
---|---|---|---|
|