![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00248.1_g00021.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 63aa MW: 7269.46 Da PI: 10.8098 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.7 | 1.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLC+aev +iifs++ klye+ss Rsa1.0_00248.1_g00021.1 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCEAEVGLIIFSPRSKLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.74 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.12E-28 | 3 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.3E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.21E-35 | 3 | 63 | No hit | No description |
Pfam | PF00319 | 4.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.3E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.3E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MVRGKTEIKR IENATSRQVT FSKRRNGLLK KAFELSVLCE AEVGLIIFSP RSKLYEFSSS 60 RFD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 4e-18 | 3 | 63 | 2 | 62 | Myocyte-specific enhancer factor 2A |
3mu6_B | 4e-18 | 3 | 63 | 2 | 62 | Myocyte-specific enhancer factor 2A |
3mu6_C | 4e-18 | 3 | 63 | 2 | 62 | Myocyte-specific enhancer factor 2A |
3mu6_D | 4e-18 | 3 | 63 | 2 | 62 | Myocyte-specific enhancer factor 2A |
5f28_A | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
5f28_B | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
5f28_C | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
5f28_D | 5e-18 | 1 | 63 | 1 | 63 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00248.1_g00021.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK230464 | 2e-59 | AK230464.1 Arabidopsis thaliana mRNA for MADS-box protein AGL14, complete cds, clone: RAFL26-03-G06. | |||
GenBank | AL078606 | 2e-59 | AL078606.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T26M18 (ESSA project). | |||
GenBank | AL161532 | 2e-59 | AL161532.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 32. | |||
GenBank | AL161533 | 2e-59 | AL161533.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 33. | |||
GenBank | CP002687 | 2e-59 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018481005.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018481006.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018481007.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018481023.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018481024.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018481025.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Refseq | XP_018681699.1 | 1e-34 | PREDICTED: agamous-like MADS-box protein AGL14 | ||||
Swissprot | O82743 | 2e-33 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | A0A199ULK7 | 8e-34 | A0A199ULK7_ANACO; Agamous-like MADS-box protein AGL14 | ||||
STRING | Bra019343.1-P | 2e-33 | (Brassica rapa) | ||||
STRING | Bo7g108370.1 | 5e-34 | (Brassica oleracea) | ||||
STRING | GSMUA_Achr5P20280_001 | 4e-34 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 7e-36 | AGAMOUS-like 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|