|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Rsa1.0_00224.1_g00008.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
WRKY |
Protein Properties |
Length: 147aa MW: 17114.3 Da PI: 9.8807 |
Description |
WRKY family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Rsa1.0_00224.1_g00008.1 | genome | RGD | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | WRKY | 104 | 8.4e-33 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt+ gC+vkk+v+r + d++vv++tYeg H h+
Rsa1.0_00224.1_g00008.1 68 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYGGCNVKKQVQRLTADQEVVVTTYEGVHSHP 126
59********************************************************7 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter |
GO:0010055 | Biological Process | atrichoblast differentiation |
GO:0032107 | Biological Process | regulation of response to nutrient levels |
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress |
GO:0048527 | Biological Process | lateral root development |
GO:0005634 | Cellular Component | nucleus |
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
Protein Sequence Length: 147 aa
Download sequence Send
to blast |
MEGYDDGSLY APFLSLKPHQ SLSMSELEQG REEASKVREG SSRSRELKKK KGKKQKFAFQ 60 TRSQVDILDD GYRWRKYGQK AVKNNKFPRS YYRCTYGGCN VKKQVQRLTA DQEVVVTTYE 120 GVHSHPIEKS TENFEHILTQ MQIYSSF
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | KM593162 | 0.0 | KM593162.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY106) mRNA, complete cds. |
Publications
? help Back to Top |
- Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] - Xu L, et al.
Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P
Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] - Velasco VM, et al.
Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] - Hossain MA, et al.
Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] - Zhang H,Huang L,Hong Y,Song F
BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] - Zhang S, et al.
The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] - Guo P, et al.
A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] - Zhang L,Chen L,Yu D
Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]
|