PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00111.1_g00052.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 167aa MW: 18542.1 Da PI: 9.8781 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 122.5 | 1.4e-38 | 52 | 110 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++++++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k Rsa1.0_00111.1_g00052.1 52 PDRIIACPRCKSMETKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKSKP 110 67889***************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-28 | 51 | 109 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.5E-32 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.043 | 56 | 110 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 58 | 94 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MATQNSQGIK LFGKTIAFNV NITQTIKSEE EKPPSDPVAR SSSSEPTVEK RPDRIIACPR 60 CKSMETKFCY FNNYNANQPR HFCKSCHRYW TAGGALRNVP VGAGRRKSKP LGRVVVGMLG 120 DGNEVHHVEL INGLLAHELH SAAAARGGFR HDFSLKRLRC FSDSEPC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00111.1_g00052.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018482242.1 | 1e-124 | PREDICTED: cyclic dof factor 4-like | ||||
Swissprot | O22967 | 3e-90 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A078HH54 | 1e-108 | A0A078HH54_BRANA; BnaA04g19980D protein | ||||
STRING | Bo4g182410.1 | 1e-108 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 6e-85 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|