PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00053.1_g00015.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 26104.8 Da PI: 10.1695 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.9 | 6.2e-10 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ ++G ++W +I++ ++++kqck rw+ +l Rsa1.0_00053.1_g00015.1 8 GVWKNTEDEILKASMMKYGRNQWGRISSLAV-RKSAKQCKARWNEWL 53 78*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 37.2 | 7e-12 | 60 | 103 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k l++ W+tIa +g Rt+ qc +r+ k+l Rsa1.0_00053.1_g00015.1 60 TEWTVEEDEKLLHLAKILPTQ-WRTIAPAVG--RTPSQCLERYEKLL 103 68*****************99.********8..**********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.787 | 1 | 53 | IPR017930 | Myb domain |
SMART | SM00717 | 7.9E-11 | 6 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-17 | 9 | 61 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 3.7E-12 | 10 | 70 | No hit | No description |
CDD | cd00167 | 1.33E-8 | 10 | 53 | No hit | No description |
SuperFamily | SSF46689 | 1.72E-20 | 33 | 105 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.773 | 54 | 107 | IPR017930 | Myb domain |
CDD | cd11659 | 2.01E-30 | 55 | 106 | No hit | No description |
SMART | SM00717 | 1.6E-12 | 58 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-14 | 62 | 104 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MRGMVKGGVW KNTEDEILKA SMMKYGRNQW GRISSLAVRK SAKQCKARWN EWLDPSIKKT 60 EWTVEEDEKL LHLAKILPTQ WRTIAPAVGR TPSQCLERYE KLLDAACGKG YEAGGDPRKL 120 GPGEIDPNPE SKPARPDAVD MEDYEMEMLS EARARFANTR GKKAKRRARE KQIQEARSLA 180 SLQKRRELRA AGIDDGKHRN KSKGKGIDYG AEIPFEKRAP AGFYDTADER |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
5xjc_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
5yzg_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
5z56_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
5z57_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
5z58_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6ff4_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6ff7_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6icz_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6id0_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6id1_L | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
6qdv_O | 1e-105 | 2 | 229 | 3 | 230 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00053.1_g00015.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018454183.1 | 1e-169 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 1e-124 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A078IAN9 | 1e-144 | A0A078IAN9_BRANA; BnaC09g14760D protein | ||||
TrEMBL | A0A3N6RCJ4 | 1e-144 | A0A3N6RCJ4_BRACR; Uncharacterized protein | ||||
TrEMBL | A0A3P6DQH6 | 1e-144 | A0A3P6DQH6_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g044140.1 | 1e-144 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16532 | 9 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 1e-124 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|