![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC877_p4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 146aa MW: 16962.4 Da PI: 10.3801 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 65 | 8.1e-21 | 35 | 83 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 +++++s + +++ R+ +i+KKA+EL +LCd+e++vi ++++g+l++++ RrC877_p4 35 PSSSYSLAATSLNSRLLTIFKKAQELTTLCDIEACVIHYGPDGELRTWP 83 689*********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51257 | 8 | 1 | 30 | No hit | No description |
SMART | SM00432 | 0.0042 | 1 | 85 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 9.349 | 44 | 86 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-14 | 47 | 119 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.8E-11 | 48 | 82 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MRRERARTRE SCFENQTRKG TMPPPLSSSC SNSSPSSSYS LAATSLNSRL LTIFKKAQEL 60 TTLCDIEACV IHYGPDGELR TWPENRDKVR DLALRYIQLD EAKRRKKSLN LYEFLNKKKE 120 KKTMTNNFKK RAKKSVEELK YPVSDH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018479659.1 | 6e-69 | PREDICTED: agamous-like MADS-box protein AGL75, partial | ||||
Swissprot | Q9FIX0 | 1e-37 | AGL81_ARATH; Agamous-like MADS-box protein AGL81 | ||||
TrEMBL | A0A397ZSC1 | 4e-62 | A0A397ZSC1_BRACM; Uncharacterized protein | ||||
STRING | Bra025607.1-P | 2e-58 | (Brassica rapa) | ||||
STRING | Bra025619.1-P | 3e-58 | (Brassica rapa) | ||||
STRING | Bo4g139560.1 | 2e-58 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM566 | 20 | 126 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40220.1 | 4e-31 | AGAMOUS-like 43 |
Publications ? help Back to Top | |||
---|---|---|---|
|