 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
RrC7158_p1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
SBP |
Protein Properties |
Length: 112aa MW: 13160.1 Da PI: 10.3068 |
Description |
SBP family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
RrC7158_p1 | genome | MSU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SBP | 128.5 | 2.6e-40 | 5 | 81 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+Cq++gC+ dls+ak+yhr+h+vCe hsk+p v+v g+e+rfCqqCsr h++sefDe+krsCr+rL++hn+rrrk+q
RrC7158_p1 5 RCQIDGCQLDLSSAKDYHRKHRVCENHSKCPLVTVGGMERRFCQQCSRLHAVSEFDEKKRSCRKRLSHHNARRRKPQ 81
6**************************************************************************97 PP
|
Nucleic Localization
Signal ? help
Back to Top |
 |
No. |
Start |
End |
Sequence |
1 | 61 | 78 | KKRSCRKRLSHHNARRRK |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | KM096582 | 6e-76 | KM096582.1 Cardamine hirsuta squamosa promoter-binding-like protein 11 mRNA, complete cds. |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Yu N,Niu QW,Ng KH,Chua NH
The role of miR156/SPLs modules in Arabidopsis lateral root development. Plant J., 2015. 83(4): p. 673-85 [PMID:26096676] - Xu M, et al.
Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] - Gao R,Wang Y,Gruber MY,Hannoufa A
miR156/SPL10 Modulates Lateral Root Development, Branching and Leaf Morphology in Arabidopsis by Silencing AGAMOUS-LIKE 79. Front Plant Sci, 2017. 8: p. 2226 [PMID:29354153] - Dotto M,Gómez MS,Soto MS,Casati P
UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. Plant Cell Environ., 2018. 41(6): p. 1394-1406 [PMID:29447428]
|