PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

TALE

Protein Properties

Length: 126aa MW: 14603.5 Da PI: 9.0471

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC6642_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	28.4	2.9e-09	82	115	21	54
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 k +yp++ ++ LA+ +gL+++q+ +WF N+R + RrC6642_p1 82 KWPYPTEGDKIALADATGLDQKQINNWFINQRKR 115 569*****************************88 PP
2	ELK	27	1e-09	36	57	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrK+++ ++sLk EFs RrC6642_p1 36 DLKDRLLRKFGSGISSLKLEFS 57 69*******************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	5.6E-6	36	57	IPR005539	ELK domain
SMART	SM01188	2.5E-4	36	57	IPR005539	ELK domain
PROSITE profile	PS51213	9.202	36	56	IPR005539	ELK domain
PROSITE profile	PS50071	12.179	56	119	IPR001356	Homeobox domain
SuperFamily	SSF46689	5.56E-19	57	124	IPR009057	Homeodomain-like
SMART	SM00389	4.0E-12	58	123	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.8E-27	61	120	IPR009057	Homeodomain-like
CDD	cd00086	1.65E-10	65	120	No hit	No description
Pfam	PF05920	6.3E-18	76	115	IPR008422	Homeobox KN domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MTILRVPEDG AVSSDEELSG GDEILQDGKQ ICEDRDLKDR LLRKFGSGIS SLKLEFSKKK 60 KKGKLPREAR QALLDWWSVH YKWPYPTEGD KIALADATGL DQKQINNWFI NQRKRHWNQS 120 ENMPYA

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269\|PubMed:16798887}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269\|PubMed:11311158, ECO:0000269\|PubMed:16798887}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018466427.1	3e-89	PREDICTED: homeobox protein knotted-1-like 6
Swissprot	Q84JS6	6e-68	KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBL	A0A397YFC1	4e-80	A0A397YFC1_BRACM; Uncharacterized protein
TrEMBL	M4DIM1	4e-80	M4DIM1_BRARP; Uncharacterized protein
STRING	Bra016348.1-P	7e-81	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM835	27	85

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.1	2e-62	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006]