 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
RrC6161_p1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
MYB_related |
Protein Properties |
Length: 88aa MW: 10092.5 Da PI: 9.7481 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
RrC6161_p1 | genome | MSU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 65 | 1.4e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+++++++G g+W++ +++ g++R++k+c++rw +yl
RrC6161_p1 14 KGPWTPEEDQKLINYIRKHGHGSWRALPKEAGLNRCGKSCRLRWTNYL 61
79********************************************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AK228268 | 1e-107 | AK228268.1 Arabidopsis thaliana mRNA for MYB family transcription factor like protein, complete cds, clone: RAFL14-72-D06. |
GenBank | ATAC018363 | 1e-107 | AC018363.8 Arabidopsis thaliana chromosome III BAC F13E7 genomic sequence, complete sequence. |
GenBank | CP002686 | 1e-107 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |