PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

NAC

Protein Properties

Length: 267aa MW: 30670.4 Da PI: 8.5574

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC4606_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	159.8	1.1e-49	14	138	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ ++++kewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v+s + v RrC4606_p1 14 LPGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFNPWDLPRVSSTGHKEWYFFCMRGRKYKNSVRPNRVTGSGFWKATGIDKPVYS-NFDCV 110 69*************************.99***********87788999***********************************.8899 PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 glkk+Lv+y g+a kg ktdW+mhe+rl RrC4606_p1 111 GLKKSLVYYLGSAGKGFKTDWMMHEFRL 138 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	53.499	13	162	IPR003441	NAC domain
SuperFamily	SSF101941	9.68E-56	13	161	IPR003441	NAC domain
Pfam	PF02365	5.1E-25	15	138	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 267 aa Download sequence Send to blast
MSGEGKEEDD EAILPGFRFH PTDEELLGYY LRRKVENKPI KLELIKQIDI YKFNPWDLPR 60 VSSTGHKEWY FFCMRGRKYK NSVRPNRVTG SGFWKATGID KPVYSNFDCV GLKKSLVYYL 120 GSAGKGFKTD WMMHEFRLSS TTKTDSTAQQ AEVWTLCRIF KRVTHKRNPT IIHPNRKSVS 180 DSCSKSSSLD SDNTSHRIVD SLSHKLHEPQ TENPYCNQLT TVGFNQPTYT CNDNNFLSFL 240 NIDGGDFIGD SASWDELRSV IDGNTKH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-52	12	162	16	165	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-52	12	162	16	165	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-52	12	162	16	165	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-52	12	162	16	165	NO APICAL MERISTEM PROTEIN
3swm_A	1e-51	12	162	19	168	NAC domain-containing protein 19
3swm_B	1e-51	12	162	19	168	NAC domain-containing protein 19
3swm_C	1e-51	12	162	19	168	NAC domain-containing protein 19
3swm_D	1e-51	12	162	19	168	NAC domain-containing protein 19
3swp_A	1e-51	12	162	19	168	NAC domain-containing protein 19
3swp_B	1e-51	12	162	19	168	NAC domain-containing protein 19
3swp_C	1e-51	12	162	19	168	NAC domain-containing protein 19
3swp_D	1e-51	12	162	19	168	NAC domain-containing protein 19
4dul_A	9e-52	12	162	16	165	NAC domain-containing protein 19
4dul_B	9e-52	12	162	16	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM975669	0.0	KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009133561.1	0.0	PREDICTED: transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	1e-161	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	M4C7V4	1e-179	M4C7V4_BRARP; Uncharacterized protein
STRING	Bra000282.1-P	1e-180	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM306	28	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	1e-150	NAC domain containing protein 42

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]