![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC4409_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 140aa MW: 16522 Da PI: 8.6003 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 67.6 | 2.4e-21 | 46 | 107 | 1 | 62 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkryk 62 +W+ +e+++L+ +r+e+++++ ++k++k lWe v++km ++gf rs++qCk+kw+nl +ryk RrC4409_p2 46 QWSIEETRELLGIREELDQTFMETKRNKLLWEVVAAKMVDKGFARSAEQCKSKWKNLVTRYK 107 7************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd12203 | 4.16E-25 | 45 | 107 | No hit | No description |
SuperFamily | SSF46689 | 7.42E-5 | 45 | 105 | IPR009057 | Homeodomain-like |
Pfam | PF13837 | 5.2E-17 | 46 | 107 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-4 | 46 | 102 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 8.037 | 47 | 103 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MDRSNPFYHR DHQLYHLIQQ QQLSLPPQSM TAAMDSGVGG GERIPQWSIE ETRELLGIRE 60 ELDQTFMETK RNKLLWEVVA AKMVDKGFAR SAEQCKSKWK NLVTRYKYKP CLHHYYAYFI 120 CGKLLCILET YSDQSQVMNR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189362 | 1e-141 | AC189362.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB045I17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018475903.1 | 6e-74 | PREDICTED: trihelix transcription factor GT-3a-like | ||||
Swissprot | Q9SDW0 | 4e-39 | TGT3A_ARATH; Trihelix transcription factor GT-3a | ||||
TrEMBL | A0A078FGM7 | 2e-54 | A0A078FGM7_BRANA; BnaA03g00390D protein | ||||
TrEMBL | A0A0D3AZB1 | 2e-54 | A0A0D3AZB1_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P5ZCN2 | 2e-54 | A0A3P5ZCN2_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P5ZXC6 | 2e-54 | A0A3P5ZXC6_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g001460.1 | 4e-55 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM37720 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G01380.1 | 2e-40 | Trihelix family protein |