![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC42264_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 188aa MW: 21461.4 Da PI: 7.566 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.4 | 3e-33 | 124 | 180 | 3 | 59 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dg++WrKYGqK+vkg+++prsYY+Ct++gC vkk+versaed+++v +tYeg+Hnh+ RrC42264_p1 124 DGFRWRKYGQKVVKGNTNPRSYYKCTYQGCGVKKQVERSAEDERAVLTTYEGRHNHD 180 9*******************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.0E-35 | 107 | 182 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.58E-29 | 114 | 182 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 33.522 | 117 | 182 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.0E-38 | 122 | 181 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.8E-26 | 124 | 180 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
KKIVETASDG QVTEIIYKGG HNHPKPEFTK RPSSSSANXR RMFNPSSVAS DQSESSSISF 60 DYSDLEQKSF KSEYGEIEEE NEQPEIKRQK REGEDEGMSV EVSRGVKEPR VVVQTISEID 120 VLIDGFRWRK YGQKVVKGNT NPRSYYKCTY QGCGVKKQVE RSAEDERAVL TTYEGRHNHD 180 IPTSLRRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-35 | 113 | 182 | 8 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-35 | 113 | 182 | 8 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253, ECO:0000269|PubMed:21336597}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430043 | 0.0 | KF430043.1 Brassica rapa WRKY transcription factor 25 (WRKY25) mRNA, complete cds. | |||
GenBank | KM593166 | 0.0 | KM593166.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY140) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006295580.1 | 1e-119 | probable WRKY transcription factor 25 | ||||
Swissprot | O22921 | 1e-109 | WRK25_ARATH; Probable WRKY transcription factor 25 | ||||
TrEMBL | R0HWQ3 | 1e-118 | R0HWQ3_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.24513s0217.1.p | 1e-119 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM27674 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30250.1 | 1e-96 | WRKY DNA-binding protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|