![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC4188_p3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 171aa MW: 19504.3 Da PI: 10.4358 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.7 | 1.8e-10 | 14 | 53 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEd++l++ + +G g+W++ R++k+c++rw +yl RrC4188_p3 14 RGLWSPEEDKKLINFISTYGHGCWSS--------RCGKSCRLRWINYL 53 788**********************9........899*********97 PP | |||||||
2 | Myb_DNA-binding | 48.7 | 1.8e-15 | 59 | 101 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+++ +E l+++++ +lG++ W+ Ia++++ gRt++++k++w+ RrC4188_p3 59 RGSFSSQESALIIELHSLLGNR-WAQIAKHLP-GRTDNEVKNFWN 101 899*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-18 | 6 | 56 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.635 | 9 | 53 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.24E-26 | 11 | 100 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-8 | 13 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-10 | 14 | 53 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.01E-10 | 17 | 53 | No hit | No description |
PROSITE profile | PS51294 | 24.804 | 54 | 108 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-25 | 57 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-14 | 58 | 106 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-14 | 59 | 102 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.16E-10 | 61 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MGHHSCCNKQ KVKRGLWSPE EDKKLINFIS TYGHGCWSSR CGKSCRLRWI NYLRPDLKRG 60 SFSSQESALI IELHSLLGNR WAQIAKHLPG RTDNEVKNFW NSSIKKKLMS RHHLNHHISS 120 MASLRTNLPC HNGFNATNGE DEGSRFMSNI IITNTNPNFI TPSHLSLPSP L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-31 | 14 | 108 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175997 | 1e-124 | AF175997.1 Arabidopsis thaliana putative transcription factor (MYB26) mRNA, complete cds. | |||
GenBank | AY519588 | 1e-124 | AY519588.1 Arabidopsis thaliana MYB transcription factor (At3g13890) mRNA, complete cds. | |||
GenBank | DQ446661 | 1e-124 | DQ446661.1 Arabidopsis thaliana clone pENTR221-At3g13890 myb family transcription factor (At3g13890) mRNA, complete cds. | |||
GenBank | DQ653083 | 1e-124 | DQ653083.1 Arabidopsis thaliana clone 0000019124_0000013170 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018490192.1 | 1e-118 | PREDICTED: transcription factor MYB26-like | ||||
Swissprot | Q9SPG3 | 1e-96 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A397ZDN3 | 1e-103 | A0A397ZDN3_BRACM; Uncharacterized protein | ||||
STRING | Bra027389.1-P | 1e-103 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12803 | 19 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13890.2 | 6e-89 | myb domain protein 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|