PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

NF-YB

Protein Properties

Length: 75aa MW: 8595.99 Da PI: 7.1802

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC3475_p4	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	81.1	1.5e-25	6	53	45	92
NF-YB 45 fvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +ts asdkcqrekrktingddllwa++tlGfe+yveplk yl++yre RrC3475_p4 6 ILTSRASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKFYLTRYRE 53 689********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.36E-17	4	54	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	3.0E-22	5	54	IPR009072	Histone-fold
Pfam	PF00808	2.0E-6	7	32	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.9E-11	15	33	No hit	No description
PRINTS	PR00615	5.9E-11	34	52	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MGVVYILTSR ASDKCQREKR KTINGDDLLW AMTTLGFEEY VEPLKFYLTR YRESPVISVA 60 SLSEAGVCCM NLLFH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-19	4	53	43	92	Transcription factor HapC (Eurofung)
4g92_B	2e-19	4	53	43	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189269	5e-54	AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018493235.1	5e-27	PREDICTED: nuclear transcription factor Y subunit B-10
Swissprot	O23310	1e-24	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	P25209	2e-24	NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBL	A0A397Y030	2e-25	A0A397Y030_BRACM; Uncharacterized protein
TrEMBL	A0A3P5Y537	3e-25	A0A3P5Y537_BRACM; Uncharacterized protein (Fragment)
TrEMBL	M4CRZ9	2e-25	M4CRZ9_BRARP; Uncharacterized protein
STRING	Bra006991.1-P	4e-26	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	5e-27	nuclear factor Y, subunit B3

Publications ? help Back to Top
Li XY, et al. Evolutionary variation of the CCAAT-binding transcription factor NF-Y. Nucleic Acids Res., 1992. 20(5): p. 1087-91 [PMID:1549471] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]