![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC3447_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 139aa MW: 16179.7 Da PI: 7.8312 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.5 | 2.9e-41 | 62 | 138 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C+ad+s+ak+yh+rhkvCe+h+kap+v + g qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk+++ RrC3447_p1 62 CQVERCTADMSRAKQYHKRHKVCEFHAKAPAVRIFGGYQRFCQQCSRFHELREFDEAKRSCRRRLAGHNERRRKSTN 138 **************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 9.9E-55 | 1 | 139 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.1E-31 | 55 | 123 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.428 | 59 | 136 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.31E-36 | 61 | 137 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.8E-31 | 62 | 135 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MSVRRSNADG KRSLREMSEE EEEDEDTFEE EDNGGEQEQE EALEKKQKGK AASSSTSSGV 60 SCQVERCTAD MSRAKQYHKR HKVCEFHAKA PAVRIFGGYQ RFCQQCSRFH ELREFDEAKR 120 SCRRRLAGHN ERRRKSTNE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-38 | 54 | 135 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape. {ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:16914499, ECO:0000269|PubMed:9301089}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018465582.1 | 5e-77 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | P93015 | 6e-57 | SPL3_ARATH; Squamosa promoter-binding-like protein 3 | ||||
TrEMBL | A0A0D3B4R8 | 3e-64 | A0A0D3B4R8_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6ATU2 | 3e-64 | A0A3P6ATU2_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g027460.1 | 5e-65 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 9e-45 | squamosa promoter binding protein-like 3 |