PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC33533_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 66aa    MW: 7804.06 Da    PI: 4.622
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC33533_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.25.9e-18956149
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                 +ppGfrFhPt+eelv +yL +k+++ k +l +vi e+d+yk+ePwd++ 
  RrC33533_p1  9 MPPGFRFHPTEEELVGYYLDRKINSMKSSL-DVIVEIDLYKMEPWDIQV 56
                 79*************************999.99**************84 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-18455IPR003441NAC domain
PROSITE profilePS5100518.696966IPR003441NAC domain
PfamPF023651.1E-81052IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MDNIMQSCMP PGFRFHPTEE ELVGYYLDRK INSMKSSLDV IVEIDLYKME PWDIQVNLLH  60
GMALHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-149661572Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0216653e-64AC021665.7 Arabidopsis thaliana chromosome 1 BAC F17M19 genomic sequence, complete sequence.
GenBankCP0026843e-64CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018462524.15e-33PREDICTED: NAC domain-containing protein 30-like
SwissprotQ9C8W93e-32NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A1J3DBN52e-31A0A1J3DBN5_NOCCA; NAC domain-containing protein 7
TrEMBLA0A1J3H5423e-33A0A1J3H542_NOCCA; NAC domain-containing protein 43 (Fragment)
STRINGXP_010415909.15e-31(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-34vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Kakehi J, et al.
    Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana.
    PLoS ONE, 2015. 10(1): p. e0117309
    [PMID:25625317]
  3. Li Z, et al.
    A Transcriptional and Metabolic Framework for Secondary Wall Formation in Arabidopsis.
    Plant Physiol., 2016. 172(2): p. 1334-1351
    [PMID:27566165]
  4. de Lucas M, et al.
    Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation.
    Plant Cell, 2016. 28(10): p. 2616-2631
    [PMID:27650334]
  5. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]
  6. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]