PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC3014_p3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 249aa MW: 28390 Da PI: 9.6842 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.4 | 4.2e-51 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrFhPtdeelvv+yLk+kv ++l++ ++i+++d+++++PwdLp + eke yfFs+r+ ky++g+r+nrat sgyWkatg dk+v+++ +++ RrC3014_p3 14 LPPGFRFHPTDEELVVQYLKRKVLCSPLPA-SIIPDFDVCRADPWDLPGN---LEKERYFFSTREAKYPNGNRSNRATGSGYWKATGIDKRVVTSrGNQ 108 79****************************.89***************44...4789********************************9999885777 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 vglkktLvfykg+ p+g++tdW+mheyrl RrC3014_p3 109 IVGLKKTLVFYKGKPPHGSRTDWIMHEYRL 138 7***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.89E-60 | 10 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.288 | 14 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.6E-27 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MDKVKLVKNG VMRLPPGFRF HPTDEELVVQ YLKRKVLCSP LPASIIPDFD VCRADPWDLP 60 GNLEKERYFF STREAKYPNG NRSNRATGSG YWKATGIDKR VVTSRGNQIV GLKKTLVFYK 120 GKPPHGSRTD WIMHEYRLSS SPPSSMGPTQ NWVLCRIFLK KRAGNKSDDD DGDNRSIRYD 180 NDQIEIITTN QTEDKTKPIF FDFMRKERTA DLNLLPSSPS SNHASSGLTT ELFSSDEETS 240 SCNSFRRNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-51 | 12 | 166 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-51 | 12 | 166 | 18 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-51 | 12 | 166 | 15 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-51 | 12 | 166 | 15 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF957837 | 0.0 | JF957837.1 Brassica napus NAC5 mRNA, complete cds. | |||
GenBank | KC966759 | 0.0 | KC966759.1 Brassica napus NAC transcription factor 83 (NAC83.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018442671.1 | 0.0 | PREDICTED: NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 1e-149 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A078F9L0 | 1e-169 | A0A078F9L0_BRANA; BnaC09g43890D protein | ||||
TrEMBL | A0A0D3EFU8 | 1e-169 | A0A0D3EFU8_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6E872 | 1e-169 | A0A3P6E872_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g168950.1 | 1e-170 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1806 | 27 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-144 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|