 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
RrC27413_p1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
Family |
HB-other |
Protein Properties |
Length: 56aa MW: 6609.62 Da PI: 8.0394 |
Description |
HB-other family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
RrC27413_p1 | genome | MSU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 27.2 | 6.5e-09 | 17 | 51 | 3 | 37 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkkl 37
k ++t+eq+e+Le+l++ +++ps +r++L +++
RrC27413_p1 17 KYVRYTPEQVEALERLYHDCPKPSSIRRQQLIREC 51
5679**************************98776 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation. May regulates procambial and vascular tissue formation or maintenance, and vascular development in inflorescence stems. {ECO:0000269|PubMed:15598805, ECO:0000269|PubMed:15705957, ECO:0000269|PubMed:16617092}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By auxin. Repressed by miR165 and miR166. {ECO:0000269|PubMed:15773855, ECO:0000269|PubMed:16033795, ECO:0000269|PubMed:16617092, ECO:0000269|PubMed:17237362}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | JN975042 | 9e-64 | JN975042.1 Brassica napus corona (CNA.2) gene, partial sequence. |
GenBank | JN975043 | 9e-64 | JN975043.1 Brassica napus corona (CNA.1) gene, partial sequence. |