PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2563_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 206aa MW: 23589.1 Da PI: 9.1307 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.7 | 3.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+ly++ss RrC2563_p1 9 KRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 83.6 | 4.4e-28 | 81 | 170 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ + +q+e+a Lk++++nLq+++R+++Ge+L+ Ls+++Lq+Le+qLe sl+ +R kK+++l+e+i+el + + +++en +L+kk+ RrC2563_p1 81 NPASEIKFWQNEAAILKRQLHNLQENHRQMMGEELSGLSVEDLQKLENQLEMSLRDVRMKKEQMLIEEIKELNREGNLVHQENLDLQKKV 170 678899**********************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.071 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.39E-43 | 2 | 73 | No hit | No description |
SuperFamily | SSF55455 | 4.19E-32 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51353 | 9.012 | 65 | 206 | IPR006660 | Arsenate reductase-like |
Pfam | PF01486 | 4.2E-26 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.618 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010440 | Biological Process | stomatal lineage progression | ||||
GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MGRGKIAIKR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYDFSSS 60 SMKSVIERYR DAKCDTNSEM NPASEIKFWQ NEAAILKRQL HNLQENHRQM MGEELSGLSV 120 EDLQKLENQL EMSLRDVRMK KEQMLIEEIK ELNREGNLVH QENLDLQKKV SLMHQQNMEL 180 HKKVSEVEGV KSANKTSLLT NGLDIG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00410 | DAP | Transfer from AT3G57230 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT030046 | 0.0 | BT030046.1 Arabidopsis thaliana At3g57230 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018484418.1 | 1e-148 | PREDICTED: agamous-like MADS-box protein AGL16 | ||||
Refseq | XP_018484419.1 | 1e-148 | PREDICTED: agamous-like MADS-box protein AGL16 | ||||
Swissprot | A2RVQ5 | 1e-129 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A078IH39 | 1e-140 | A0A078IH39_BRANA; BnaA03g51000D protein | ||||
TrEMBL | A0A397L3M6 | 1e-140 | A0A397L3M6_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DMA6 | 1e-140 | M4DMA6_BRARP; Uncharacterized protein | ||||
STRING | Bra017638.1-P | 1e-141 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM530 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 1e-132 | AGAMOUS-like 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|