PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 83aa MW: 9692.89 Da PI: 10.2799

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC18210_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.3	8.5e-19	21	68	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l++ ++ +G g+W++ +r+ g+ Rt+k+c++rw++yl RrC18210_p1 21 RGPWTAEEDFKLANHIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68 89*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.937	16	72	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.5E-22	16	78	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.8E-19	16	78	IPR009057	Homeodomain-like
SMART	SM00717	5.9E-14	20	70	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-16	21	68	IPR001005	SANT/Myb domain
CDD	cd00167	3.11E-11	23	68	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MDEKGRSFKN NNMEDEMDLK RGPWTAEEDF KLANHIATHG EGRWNSLSRC AGLQRTGKSC 60 RLRWLNYLRP DVRRGNITLK NNS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:20921156, ECO:0000269\|PubMed:23952703}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF738287	1e-110	KF738287.1 Brassica napus MYB transcription factor 108-2 (MYB108-2.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018490800.1	2e-52	PREDICTED: transcription factor MYB108-like
Swissprot	Q9LDE1	1e-48	MY108_ARATH; Transcription factor MYB108
TrEMBL	A0A1J3GEQ0	3e-50	A0A1J3GEQ0_NOCCA; Uncharacterized protein (Fragment)
TrEMBL	A0A3P5ZN60	5e-48	A0A3P5ZN60_BRACM; Uncharacterized protein
TrEMBL	M4CAH3	5e-48	M4CAH3_BRARP; Uncharacterized protein
STRING	Bra001202.1-P	8e-49	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G06490.1	6e-51	myb domain protein 108

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cheng HQ, et al. The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection. J. Exp. Bot., 2016. 67(6): p. 1935-50 [PMID:26873979] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Chou ML, et al. The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana. Int J Mol Sci, 2018. [PMID:29937503]