![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC17819_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 220aa MW: 25534.8 Da PI: 9.9687 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.4 | 1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ienk+ rq+tfskRrng++KKA+ELSvLCda+va i+fs++gklye+ss RrC17819_p1 9 KKIENKTSRQITFSKRRNGLFKKAHELSVLCDAQVAAIVFSQSGKLYEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 56.1 | 1.7e-19 | 90 | 171 | 16 | 96 |
K-box 16 slqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 +l++e++ + k+i+ L+ ++ +l+G++L+s+sl eLq +e+q++ksl+ iRs+K +l+ +q+ +l+ ke+el +e ++Lr RrC17819_p1 90 ELKKEIDIMVKKIDLLEvHQMLKLMGKGLGSCSLAELQDIETQIDKSLRIIRSRKADLYADQLLKLKDKERELLDERRRLRG 171 6899*************9999*********************************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.001 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.1E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-33 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.33E-43 | 3 | 75 | No hit | No description |
Pfam | PF00319 | 1.5E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.493 | 88 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.2E-17 | 90 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MVRGKIEIKK IENKTSRQIT FSKRRNGLFK KAHELSVLCD AQVAAIVFSQ SGKLYEFSSS 60 EMEKTIERYR KFSNDYFAPG RPQVELYMLE LKKEIDIMVK KIDLLEVHQM LKLMGKGLGS 120 CSLAELQDIE TQIDKSLRII RSRKADLYAD QLLKLKDKER ELLDERRRLR GEEIRETLVR 180 PMLPVTLHTE KNETIGACRT SKRSSEVETD LFIGLPATRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 3e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 3e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 3e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232439 | 3e-85 | AC232439.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003D07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018475523.1 | 1e-139 | PREDICTED: MADS-box protein AGL71-like isoform X1 | ||||
Refseq | XP_018475524.1 | 1e-139 | PREDICTED: MADS-box protein AGL71-like isoform X2 | ||||
Swissprot | Q9LT93 | 1e-100 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | A0A397ZUY7 | 1e-127 | A0A397ZUY7_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EK37 | 1e-127 | M4EK37_BRARP; Uncharacterized protein | ||||
STRING | Bra029154.1-P | 1e-128 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.3 | 4e-95 | AGAMOUS-like 71 |