PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

MYB_related

Protein Properties

Length: 169aa MW: 19269.6 Da PI: 6.8691

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
RrC1762_p1	genome	MSU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.9	9.5e-18	42	85	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg +T E++++ +++ qlG++ W++Ia++++ gRt++++k++w++ RrC1762_p1 42 RGGFTDAEEDRIMELHSQLGNR-WSKIASHFP-GRTDNEIKNHWNT 85 788*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.054	23	36	IPR017877	Myb-like domain
SuperFamily	SSF46689	1.03E-22	23	95	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.0E-5	23	35	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.1E-26	36	92	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.096	37	91	IPR017930	Myb domain
SMART	SM00717	4.4E-15	41	89	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-15	42	85	IPR001005	SANT/Myb domain
CDD	cd00167	5.26E-11	45	85	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MASIAGESSP NLQSFHVHEG LLRCGKSCRL RWINYLRPDL KRGGFTDAEE DRIMELHSQL 60 GNRWSKIASH FPGRTDNEIK NHWNTKIKKK MKHLGLDQAT HEPMNSITDQ TESKQITNPN 120 MCSTSSMERE ETKDEPKDDV ITETSKTIIV TNNGKELQAE NCKTLCAEE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-21	23	91	40	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018444880.1	1e-99	PREDICTED: myb-related protein 315
Swissprot	Q9C7U7	5e-45	MYB20_ARATH; Transcription factor MYB20
TrEMBL	A0A0D3AIZ6	5e-95	A0A0D3AIZ6_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6CUD8	5e-95	A0A3P6CUD8_BRAOL; Uncharacterized protein
STRING	Bo2g011790.1	9e-96	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14340.1	7e-85	myb domain protein 40

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]