![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC15252_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 130aa MW: 15268.9 Da PI: 10.186 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 71.4 | 7.9e-23 | 9 | 47 | 1 | 39 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevavii 39 krien + rqvtfskRr+g++KKA+ELSvLCda+va i RrC15252_p1 9 KRIENLTSRQVTFSKRRKGLFKKAHELSVLCDAQVAAIK 47 79*********************************9885 PP | |||||||
2 | K-box | 50.8 | 7.3e-18 | 66 | 129 | 9 | 72 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 ++++ ++l++e+ + ++ie Lq R+l+G+dL+s+s++eL+++ +++eksl+++Rs+K ++ RrC15252_p1 66 QKQQYVQELKNEMVIMMDKIELLQLHSRKLMGQDLDSCSVEELNEISTKIEKSLTNVRSRKIKM 129 6778889*****************999**********************************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 25.091 | 1 | 46 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.49E-22 | 1 | 46 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.8E-27 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-20 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.6E-20 | 10 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-20 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-20 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.2E-15 | 67 | 127 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.035 | 71 | 130 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MVRGKIEIKR IENLTSRQVT FSKRRKGLFK KAHELSVLCD AQVAAIKMIE RCEIQRNEYT 60 GAENLQKQQY VQELKNEMVI MMDKIELLQL HSRKLMGQDL DSCSVEELNE ISTKIEKSLT 120 NVRSRKIKMR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232542 | 2e-39 | AC232542.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH005L20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018466616.1 | 1e-82 | PREDICTED: MADS-box protein AGL72-like, partial | ||||
Swissprot | Q9FLH5 | 1e-50 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A078IVV5 | 5e-72 | A0A078IVV5_BRANA; BnaA01g35210D protein | ||||
TrEMBL | A0A398AM49 | 4e-72 | A0A398AM49_BRACM; Uncharacterized protein | ||||
STRING | Bra013891.1-P | 2e-72 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 4e-53 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|