PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC14263_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 98aa MW: 10568.8 Da PI: 8.2928 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 103.6 | 1.3e-32 | 30 | 85 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+CaACgCHR+FHRre+e RrC14263_p1 30 GVRYSECQKNHAAAVGGYAVDGCREFMASNGEEGTVAALTCAACGCHRSFHRRETE 85 79***************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-32 | 1 | 95 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 2.5E-29 | 31 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 2.5E-28 | 32 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.8 | 33 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MRKRQVVLRR ASPEEPSRSS STASSRMVRG VRYSECQKNH AAAVGGYAVD GCREFMASNG 60 EEGTVAALTC AACGCHRSFH RRETEVVCDC DSPPSTGN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC155348 | 1e-137 | AC155348.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' chromosome Cytogenetic chromosome 1 clone KBrH097M21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018437517.1 | 3e-66 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_018437518.1 | 3e-66 | PREDICTED: mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 1e-48 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A0D3E0L7 | 3e-61 | A0A0D3E0L7_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6DA06 | 3e-61 | A0A3P6DA06_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g008720.1 | 5e-62 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-47 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|