![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC12142_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 144aa MW: 16871.6 Da PI: 10.577 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 59.5 | 8.6e-19 | 2 | 46 | 9 | 53 |
---TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS SBP 9 adlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 +dls ak+yhrrhkvCevhska ++lv +++qrfCqqCsr +ls RrC12142_p1 2 EDLSVAKDYHRRHKVCEVHSKAIKALVGNQMQRFCQQCSRCKSLS 46 69**************************************98886 PP | |||||||
2 | SBP | 51.9 | 2e-16 | 61 | 91 | 48 | 78 |
SEEETTT--SS--S-STTTT-------S--- CS SBP 48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78 rfh lsefDe+krsCrrrLa+hn+rrrk+q+ RrC12142_p1 61 RFHLLSEFDEGKRSCRRRLAGHNKRRRKTQP 91 9***************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 23.23 | 1 | 89 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.7E-22 | 2 | 76 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.79E-17 | 2 | 46 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.3E-13 | 3 | 46 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.26E-13 | 61 | 94 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.3E-8 | 61 | 88 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MEDLSVAKDY HRRHKVCEVH SKAIKALVGN QMQRFCQQCS RCKSLSYRVT AVSSLELLAV 60 RFHLLSEFDE GKRSCRRRLA GHNKRRRKTQ PEEIVAPHNN TSNMDVGTMV VDLMGLRQCH 120 KGSNYFRYLT KLKRYRCLWI LSQS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-22 | 3 | 88 | 19 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018484597.1 | 1e-44 | PREDICTED: squamosa promoter-binding-like protein 16 | ||||
Swissprot | Q700C2 | 9e-39 | SPL16_ARATH; Squamosa promoter-binding-like protein 16 | ||||
TrEMBL | A0A078G1G7 | 2e-42 | A0A078G1G7_BRANA; BnaC02g24160D protein | ||||
TrEMBL | A0A0D3AR23 | 3e-42 | A0A0D3AR23_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6DVZ9 | 2e-42 | A0A3P6DVZ9_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g091010.1 | 5e-43 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76580.1 | 4e-41 | SBP family protein |