![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.6G270000.1.p | ||||||||
Common Name | PRUPE_ppa021145mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 93aa MW: 10646.5 Da PI: 9.9793 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.4 | 8e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+d+++ +G+g+W++ ++ g+ R++k+c++rw +yl Prupe.6G270000.1.p 14 KGAWTKEEDQRLIDYIRVHGKGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.222 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-21 | 13 | 60 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.27E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.44E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.7E-10 | 61 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.336 | 66 | 92 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MGRSPCCEKV HTNKGAWTKE EDQRLIDYIR VHGKGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGKAPL KL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-17 | 13 | 86 | 26 | 98 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and weakly in roots and stems. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.6G270000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT159236 | 1e-138 | KT159236.1 Prunus persica R2R3-MYB transcription factor (MYB20) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022727844.1 | 2e-57 | transcription repressor MYB6-like isoform X1 | ||||
Swissprot | P81395 | 3e-55 | MYB30_ANTMA; Myb-related protein 330 | ||||
TrEMBL | A0A251NZU3 | 6e-61 | A0A251NZU3_PRUPE; Uncharacterized protein | ||||
STRING | XP_008219033.1 | 1e-55 | (Prunus mume) | ||||
STRING | EMJ09816 | 3e-58 | (Prunus persica) | ||||
STRING | cassava4.1_032831m | 3e-56 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09460.1 | 5e-57 | myb domain protein 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.6G270000.1.p |
Entrez Gene | 18772476 |
Publications ? help Back to Top | |||
---|---|---|---|
|