PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.6G147600.4.p

Common Name

PRUPE_ppa011880m2g

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

YABBY

Protein Properties

Length: 159aa MW: 17493.5 Da PI: 9.329

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.6G147600.4.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	172.6	2.5e-53	1	130	34	170
YABBY 34 vvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqr 124 +vtvrCGhC++llsvn+ + q a s+ d ++l+ +++ ++e+ ++ +++s++ s+ s+ +++ e ++ p + p irPPekrqr Prupe.6G147600.4.p 1 MVTVRCGHCANLLSVNMGASLQSNAFPSQ-D----PQLQ-KHHLSSEDSNKSCGSSSSSKCSKFSHPFESVELHDQPSISP-IRPPEKRQR 84 69*************999988888876.3....3333.33333333333333333333333444556666777776667.9**** PP YABBY 125 vPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 vPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl Prupe.6G147600.4.p 85 VPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 130 ******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	3.2E-54	1	130	IPR006780	YABBY protein
SuperFamily	SSF47095	1.24E-8	74	123	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	2.7E-5	78	124	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development
GO:0010158	Biological Process	abaxial cell fate specification

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MVTVRCGHCA NLLSVNMGAS LQSNAFPSQD PQLQKHHLSS EDSNKSCGSS SSSKCSKFSH 60 PFESVELHDQ PSISPIRPPE KRQRVPSAYN RFIKEEIQRI KASNPDISHR EAFSTAAKNW 120 AHFPHIHFGL KLDGSKQPKL DQTFAGGDQG TQKSSGFY*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ppe.1224	0.0	fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10457020}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.6G147600.4.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF147402	4e-47	EF147402.1 Populus trichocarpa clone WS01230_J05 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007207250.2	1e-115	putative axial regulator YABBY 2 isoform X2
Refseq	XP_020423065.1	1e-114	putative axial regulator YABBY 2 isoform X1
Swissprot	Q9XFB0	3e-60	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	A0A251NQJ2	1e-113	A0A251NQJ2_PRUPE; Uncharacterized protein
TrEMBL	A0A251NQK5	1e-113	A0A251NQK5_PRUPE; Uncharacterized protein
STRING	EMJ08449	1e-114	(Prunus persica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	9e-57	YABBY family protein

Link Out ? help Back to Top
Phytozome	Prupe.6G147600.4.p
Entrez Gene	18775411

Publications ? help Back to Top
Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]